Der German is Gebroken

I’ve written about making fun of the German language before, which included references to Fraulein Bo-peepen And More Tales Mein Grossfader Told, by Dave Morrah, and John Hulme’s Mörder Guss Reims – the Gustav Leberwurst Manuscript, but recently while scanning papers from my mother’s estate, and she has a lot of them, including things her own mother collected, I ran across a few previously unseen gems.

Before we go on, remember that a working knowledge of German was necessary for a serious study of organic chemistry in days gone by; Beilstein’s Handbuch der organischen Chemie was the seminal reference book, so famous that Isaac Asimov wrote a story using the book and the author’s name as its central conceit (“What’s in a Name”).

The following material was found in Newscripts, a column that ran in “Chemical and Engineering News”

Once upon a time, the requirements for a degree in chemistry included reasonable competence in a foreign language. A jocular essay in fractured German in those days could be counted on to convulse a chemical audience. Two such yarns that appeared during 1952 were” Der Franklin und sein Keit” (April 28) and “Der Volta und seine Peils” (June 2). Language skills were declining even then, however, and Newscripts noted only five years later that “To keep up with rapid advances in technology … scientists have had to develop new terms-and also ways of translating these terms into foreign languages. An up-to-date English-German glossary … includes:

Guidance system: Das Schteerenwerke.
“Preset guidance: Das senden offen mit ein pattenbacker und finger gekrossen Schteerenwerke.
“Warhead: Das Laudenboomer.
“Nuclear warhead: Das eargeschplitten Laudenboomer.
“Project engineer: Das Schwettenoudter.” (Sept. 9, 1957)

The following stories should be read aloud in a heavy Colonel Klink accent for best effect:

Der Franklin und sein Keit

(Originally printed, we are told, in the Journal of the Electrochemical Society, some 30 years ago)

Der Franklin der war ein rechter Tschinius, immer bissig mit Inwentschiuns, wie zum Beispiel sein Stohf, den wir bis heute noch bei seinen Namen kennen. “Bei Galli”-so meinte er eines Tages-“es ist doch e’ Skandel und e’ Schem, dass so viele Häuser von Leitning gestreikt werden. Wenn ich das prewenten könnte, es wäre schur eine kühle Million wert. Aber was ist denn eigentlich der Leitning? Ennihau, ich habe e’ Honntsch!”

Also baute er ein Keit, mit einer langen String mit e’ Kieh am Ende, und geht in die Beckjahrt, ihn zu fleihen. Und wenn es zu regnen anfängt, und der Leitning flescht, so steckte er e’ Knockel an den Kieh; un achherrjesses! der Spark rippt ihm zwei Fingernehls und e’ Viertelskwerrfuss Skinn von der Hand ab; und der Franklin weiss nun, von dem Schock, dass Leitning und Electrozität alleik sind.

Sodann steigt er auf die Ruf mit e’ Bumberschuht mit e’ stiehl Händel, und wartet für mehr Leitning; aber die Deborah – das war sein Frau – die hollert, das Sopper sei rettig, und er soll Hörriopp machen und aufwaschen und ins Haus kommen. Also machte er den Bumberschuht an den Daunspaut fest – und das war der erste Leitningrad.

Der Franklin war lockig und so lebte er noch vierzig Jahre, und hatte alle gestumpft-besonders die Lehdis; aber ein russicher Physiker, der den Keitexperiment repieten wollte, wure vom Leitning gekillt;-was alles pruhft, der wahre Scientist hat nicht senns genug, vom Rehn auszukiepen.

– Sol Nemen

Der Volta und seine Peils

Die Studenten in der Universitaet zu Pavia waren Holitaerrers,—die Strietlemps haben sie am Halloween gebostet und die Garbetschkenns gedommpt—und sieben Mal in einer Nacht haben sie dem Prof. Alessandro Volta den Dorrnacker geklappert. Da hat der gute Doktor doch endlich ein Fiuss gebloht. “Nun ist doch mein Limit gerietscht” fuhmt er, “elende Lohfers, euch will ich fixen!”

Und so denkt er nun, wenn andere mit blos zwei Metallstuecke Froschschenkel twitschen machen konnten, was wuerde er nicht selbst mit e’ Koppel hundert Metallpaare akkomplischen! Also nimmt er e’ silber Bock, un e’ Zinkwascher, und e’ Stueck Blattingpapier das er erst in Salzwasser gedunkt hat, un noch e’ Bock, und wieder e’ Zink, und so an, bis er ein Peil von eibettju ennihau 300 Volts hat. Dann hitscht er ein Ende des Peils mit e’ Weier an den Dorrnacker, un graundet das andere Ende, und ohboi! der naechste Bursche, der den Nacker retteln will, wird selbst fuer e’ Lup genackt.

Der Volta reported sein Socksess an dei Royal Society in London, und bald haben die Scientists in allen Laendern auch Peils, – noch viel groesser wie Voltas – und fangen an, Leute zu schocken, und zu elektroleisen, un sogar zu plehten, wie niemand sein Bissness. In Poland gab es zwei Professore, die hatten e’ Brehnsturm und haben die Weiers von der Batterie getehstet! Der erste insistet, es schmeckte sauer, der zweite meint nein, mehr wie Seife; der erste sagt, “Mein Meind is aufgemacht, es ist doch so”; der andere sagt “Balloni!”; und so kommt es, dass noch heute an jeder Batterie e’ positiver Pol und e’ negativer Pol ist.

Volta wurde fuer seine Arbeit von Napoleon geonnert, und seine Stadt hat ihn Praeseident fuer Lief von der Pavianerhalloweenneusundhellrehsungsverhinderungsgesellschafft gemacht. Zwar haben die Buben nie wieder mit seinem Dorrknacker gemonnkieht, doch schon am naechsten Halloween haben sie sien Beckhaus getippt und einen sehr toten Skonk durch sein Fenster gehieft. Und so haben ihm seine Peils am Ende doch viel Trubel gemacht.

I’ve mentioned playing around with French and Latin previously; stay tuned for a little fun with italian, soon to come.

Der Old Wolf hat gespoken.

My First German Scam Email

The phishermen are casting a wide net.

Here’s my first phishing email in German, with headers:

Return-Path: majorapp@bronco.websitewelcome.com
Received: from imta34.emeryville.ca.mail.comcast.net (LHLO
imta34.emeryville.ca.mail.comcast.net) (76.96.28.168) by
resmail-po-420v.sys.comcast.net with LMTP; Tue, 15 Jul 2014 13:17:57 +0000
(UTC)
Received: from bronco.websitewelcome.com ([192.185.82.92])
by imta34.emeryville.ca.mail.comcast.net with comcast
id SdHw1o0041zWx2w0adHwbd; Tue, 15 Jul 2014 13:17:56 +0000
X-CAA-SPAM: 00000
X-Authority-Analysis: v=2.1 cv=P/wD2Ewu c=1 sm=1 tr=0
a=KztXjUqHRyz9kbsNwKbgzg==:117 a=8FReB3YSAAAA:8 a=C_IRinGWAAAA:8
a=GGcpBh7Jt_oA:10 a=trIDVAjzH2wA:10 a=rKpt8qlD2zIA:10 a=aYsrNlUn7DwA:10
a=IkcTkHD0fZMA:10 a=cc8bsT4k8mMA:10 a=srLljQ7VAAAA:8 a=QpSK2HJ8AAAA:8
a=QAZS5B4ip-KZLdxwkisA:9 a=8PHepCJaBy8WvsX-:21 a=QEXdDO2ut3YA:10
a=_W_S_7VecoQA:10 a=6xz8xM_uv-EA:10
Received: from majorapp by bronco.websitewelcome.com with local (Exim 4.82)
(envelope-from <majorapp@bronco.websitewelcome.com>)
id 1X72cF-0004OT-QT
for [redacted]; Tue, 15 Jul 2014 08:17:55 -0500
To: [redacted]
Subject: Amazon.de Kundenservice
X-PHP-Script: majorappliancesinfo.com/ for 93.93.69.158
From: accountcheck@amazon.de <accountcheck@amazon.de>
Content-type: text/html; charset=utf-8
Reply-To: accountcheck@amazon.de
Message-Id: <E1X72cF-0004OT-QT@bronco.websitewelcome.com>
Date: Tue, 15 Jul 2014 08:17:55 -0500
X-AntiAbuse: This header was added to track abuse, please include it with any abuse report
X-AntiAbuse: Primary Hostname – bronco.websitewelcome.com
X-AntiAbuse: Original Domain – comcast.net
X-AntiAbuse: Originator/Caller UID/GID – [3638 32003] / [47 12]
X-AntiAbuse: Sender Address Domain – bronco.websitewelcome.com
X-BWhitelist: no
X-Source-IP:
X-Exim-ID: 1X72cF-0004OT-QT
X-Source: /opt/php54/bin/php-cgi
X-Source-Args: /opt/php54/bin/php-cgi /home/majorapp/public_html/wp-content/themes/twentyten/images/headers/sistems.php
X-Source-Dir: majorappliancesinfo.com:/public_html/wp-content/themes/twentyten/images/headers
X-Source-Sender:
X-Source-Auth: majorapp
X-Email-Count: 9
X-Source-Cap: bWFqb3JhcHA7emV2eW9zMjticm9uY28ud2Vic2l0ZXdlbGNvbWUuY29t

Wir brauchen Ihre Hilfeaufgrund der steigenden Zahlungsausfalle mittels Lastschrift- und Rechnungszahlung,
ist es in Zukunft leider nicht mehr moglich, eine Zahlung bei Amazon.de mit diesen Zahlungsarten ohne hinterlegte Kreditkarte zu tatigen. Daher ist es notwendig, dass alle Kunden eine Kreditkarte als Zahlungsmittel hinterlegen.

Sollten Sie bereits eine Kreditkarte hinterlegt haben, bitten wir Sie, die bereits hinterlegte Kreditkarte zu verifizieren. Sollten Sie noch keine Kreditkarte besitzen, legen wir Ihnen gerne die Amazon VISA-Kreditkarte ans Herz. Nutzen Sie zur Verifizierung bitte den folgenden Link: Zum Sicherheitsverfahren – http://amazon.acountingdatacheck.com (Notice that this is not a valid Amazon.de URL)

Bitte beachten Sie, dass Sie Ihr Amazon.de-Kundenkonto ohne hinterlegte Kreditkarte in Zukunft nicht mehr nutzen konnen.

Mit freundlichen Grußen,
Ihr Amazon.de Kundenservice

In short, they’re saying that I can no longer use my current credit card and need to add a couple more. The bogus link takes you to a bogus Amazon page
bogus
where you get to divulge all of your credit card and banking data.
Please be careful out there. So many evil and unprincipled drones want your money, and will stop at nothing to get it.
The Old Wolf has spoken.

Donnerwetter! German’s longest word stricken

If you’ve ever read Mark Twain’s A Tramp Abroad, you have probably encountered Appendix D: The Awful German Language. Therein, Twain waxes eloquent about the vagaries of the Teutonic tongue and mentions the habit of the German language to smash nouns together into long, unreadable strings. He mentions “Generalstaatsverordnetenversammlungen” (legislator meetings) and “Waffenstillstandsunterhandlungen” (cease-fire negotiations.) He does not mention “Donaudampfschifffahrtsgesellschaftskapitaenswitwe” (the widow of a captain of the Danube Steamship Voyage Company), and I have seen longer versions having to do with the cleaning lady of the captain’s cabin, but this one is somewhat sniffed at by German purists.

enhanced-buzz-15726-1363114236-3

 

“Hardwood floor sander rental”

Now it appears that the longest official word in the German dictionary has been stricken, because it’s no longer needed.

the Rindfleischetikettierungsüberwachungsaufgabenübertragungsgesetz, or “law delegating beef label monitoring,”  was introduced by Germany in 1999 as part of measures against mad cow disease. But the DPA news agency reported today the law was removed from the books last week because European Union regulations have changed. Just to show you how these monsters are cobbled together:

  • Rind (cow)
  • Fleisch (flesh) [Rindfleisch -> “beef”]
  • Etikettierung (labeling)
  • Überwachung (monitoring)
  • Aufgabe (task)
  • Übertragung (delegation)
  • Gesetz (law)

The additional letters between the nouns are there to make things flow smoothly, in the same way as we take “girls” and “baseball” and “team” and come up with “girls’ baseball team.” And that’s really all they are doing – they just happen to cram everything together into one word.

German has other peculiarities, among which are the maddening tendency to throw all their verbs to the end of a very long clause or sentence. I’m currently reading The Lord of the Rings (Der Herr der Ringe) in German; I can’t wait to get to Volume 3 to find out what happens, because that’s where all the verbs are. [1]

But with the “Längsthauptwortsabschaffung” (longest noun elimination, and I just made that up) having been performed, what’s left as the longest official word? That honor falls to Kraftfahrzeughaftpflichtversicherung (automobile liability insurance)

For what it’s worth, “The Awful German Language” was not Twain’s only foray into German philology. In A Connecticut Yankee in King Arthur’s Court, he came up with Constantinopolitanischerdudelsackpfeifenmachersgesellschafft (İstanbul bagpipe maker company, and remember it’s İstanbul, not Constantinople), which my Teutonically-enabled friends will be quick to point out is improperly formed, but it makes a heck of a magic word. But this segues into the fact that when it comes to smashing words together, the Germans are rank amateurs when compared to Turkish.

turkish-flag-300x225

Avrupalılaştırılamayabilenlerdenmısınız? is a complete sentence, a question which means “Are you one of those who is not easily able to be Europeanized?”

Here’s how it’s formed:

  • Avrupa: Europe
  • Avrupa-lı: European
  • Avrupa-lı-laş-mak: become European
  • Avrupa-lı-laş-tır‑mak: to make European (mak is an infinitive ending)
  • Avrupa-lı-laş-tır‑ı‑l‑mak: (reflexive) to be made European (‑l‑ is a linking consonant)
  • Avrupa-lı-laş-tir‑ıl‑abil‑mek: to be capable of being Europeanized (‑mek is again the infinitive ending, changed as a result of vowel harmony)
  • Avrupa-lı-laş-tır‑ıl‑ama‑mak: not to be capable of being Europeanized
  • Avrupa-lı-laş-tır‑ıl‑ama‑y‑abil‑mek: this time the ‑abil is probability: that there is a probability that one may  not be capable of being Europeanized
  • Avrupa-lı-laş-tır‑ıl‑ama‑y‑abil‑en: the one that may not be capable of being Europeanized
  • Avrupa-lı-laş-tır‑ıl‑ama‑y‑abil‑en‑ler: the ones…..(‑ler, ‑lar is the plural suffix)
  • Avrupa-lı-laş-tır‑ıl‑ama‑y‑abil‑en‑ler‑den: of or from the ones who may not be capable of being Europeanized
  • mı? ‑ question tag (legally, this should be written separately, but it is a very common mistake not to).
  • mısınız? ‑ are you (formal or plural)

To be fair, this is a rather contrived sentence, but it’s legal and grammatical and shows how Turkish agglutination works. Pope John XXIII is reported to have said, at one point during his ten years in İstanbul as Papal Nuncio, “I am fond of the Turks…  It is my special intention, as an exercise in mortification, to learn the Turkish language.” Mortification is right.

I spent about 10 years associating with Turks, the Turkish language, and Turkey, and I would like to go on record as saying that John had the right idea. They’re lovely people, with a beautiful country and a hellish but intriguing language. I keep chipping away at Turkish, and perhaps in one or two more lifetimes I’ll be able to say more than “Günaydın, nasılsınız?”. As Robert Sheckley’s character said in “Shall we have a little talk?“, “Stop agglutinating, dammit!”

Given the events taking place in Turkey at this very moment, I pause to wish the good people of this land every good thing, and the right to freedom and self-determination.

The Old Wolf has spoken.


[1] Just kidding. All the verbs are in the appendices.